Protein Info for SM_b21555 in Sinorhizobium meliloti 1021

Annotation: potassium-efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 18 to 292 (275 residues), 263.4 bits, see alignment E=1.3e-82 PF00999: Na_H_Exchanger" amino acids 19 to 383 (365 residues), 221.8 bits, see alignment E=1.3e-69 PF02254: TrkA_N" amino acids 409 to 522 (114 residues), 78.4 bits, see alignment E=5.6e-26

Best Hits

Swiss-Prot: 50% identical to KEFX_HAEIN: Glutathione-regulated potassium-efflux system protein (kefBC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11747, glutathione-regulated potassium-efflux system protein KefB (inferred from 100% identity to sme:SM_b21555)

Predicted SEED Role

"putative Glutathione-regulated potassium-efflux system protein KefB" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UU2 at UniProt or InterPro

Protein Sequence (593 amino acids)

>SM_b21555 potassium-efflux protein (Sinorhizobium meliloti 1021)
MAAESHGIDLLPVIALLGAAVVAAPLFKRIGLGSVLGYLAAGIAIGPFGLRLLQEPSSIL
HVAELGVVMFLFIIGLEMRPSRLWGLRREIFGLGIVQVALCALLLTGVGVLTGFPVAPSF
VAGAGFVLTSTAIVMQLLEERREMAAPKGQRIVSILLVEDMAIVPLLALVAFLAPIVPGS
VAASGAIDWLSIAIGLVTIAGLVLAGRYLLNPLFGLIAGVEAREVMTAAALMVVLGSAYV
MQLGGLSMAMGAFLAGVLLSESTFRHQLEADVEPFRGILLGLFFLAVGMSLDLGVIARNW
AMILFYVAAYMVVKAIVIYLVARLFRASNWEAIERAVFMAQGGEFAFVLYAAALGTGIIS
SEENAILTAIIIVSMMVTPLLIAALRLVERNIPLSTDGVERPENLSGNVLIIGFGRVGQI
VSQVLLTRGHVISIIDTDVEMINTAREFDFKVYYGDGKRLDILHAAGAERASAIVVCVDK
ADDATKIVELIKAEFPLIPVLARASDRRHALDLITAGADFHIRETFESSLVLGQKALEAL
GADLPEVAEIIEKVRQRDEKRLELELVGGLYAGRPLFSGKLEPVEAVPPGGSA