Protein Info for SM_b21552 in Sinorhizobium meliloti 1021

Annotation: aminoglycoside 6'-N-acetyltransferase, amikacin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF13523: Acetyltransf_8" amino acids 9 to 113 (105 residues), 53.6 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: K00663, aminoglycoside N6'-acetyltransferase [EC: 2.3.1.82] (inferred from 100% identity to sme:SM_b21552)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UU4 at UniProt or InterPro

Protein Sequence (167 amino acids)

>SM_b21552 aminoglycoside 6'-N-acetyltransferase, amikacin resistance protein (Sinorhizobium meliloti 1021)
MIEFRSLTEADFLMLCEWLNSPHMRAHYQKTPITIEEVQGKYSERLSPSHPTHCHIARYN
GETFGMLQCYSLRNYPDFASEIGEQDGVAVDLFIGEERFIGKDFGKAMLRSYVLNVVPSI
FPQECFICHAKENKIAIRGSLSAGFLPYRDVIERGVESLLLSFDRPI