Protein Info for SM_b21540 in Sinorhizobium meliloti 1021

Annotation: iron uptake ABC transporter substrate-binding protein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03261: putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein" amino acids 12 to 337 (326 residues), 521.6 bits, see alignment E=4e-161 PF13531: SBP_bac_11" amino acids 28 to 281 (254 residues), 40.2 bits, see alignment E=7.1e-14 PF01547: SBP_bac_1" amino acids 41 to 279 (239 residues), 78.7 bits, see alignment E=1.7e-25 PF13416: SBP_bac_8" amino acids 42 to 282 (241 residues), 75.4 bits, see alignment E=1.4e-24 PF13343: SBP_bac_6" amino acids 75 to 313 (239 residues), 93.3 bits, see alignment E=3.4e-30

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 99% identity to smk:Sinme_4731)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q926G4 at UniProt or InterPro

Protein Sequence (340 amino acids)

>SM_b21540 iron uptake ABC transporter substrate-binding protein precursor (Sinorhizobium meliloti 1021)
MPFSKIFLGAGTALILASSAAYAETELTVYTSIEAVDLDRYKETFEKAHPDIKINWVRDS
TGVMTAKLLAEKDNPQADVVWGVAATSLLLLKSEGMLEPYSPKNVEALDPRFVDGDKPPS
WVGMDAYVAALCYNTVEAGKLGLTPPTSWKDLTKPEYKGHVVMPNPNSSGTGFLDVSAWL
QTFGEEEAWSFMDALHENIAAYTHSGSKPCKMAASGETVIGVSFEFPGAKAKTSGAPIDI
IFPSEGSGWEAEATAIIAGTANLEAAKTLVDWSISKEANEMYNVGYAVVAYPGVAKPIEN
LPDDVADKMIKNDFEWAANNRARILKEWQKRYDAKSEPKS