Protein Info for SM_b21539 in Sinorhizobium meliloti 1021

Annotation: aldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03250: putative phosphonoacetaldehyde dehydrogenase
  • amino acids 10 to 484 (475 residues), 853.6 bits, E=1.9e-261
• PF00171: Aldedh
  • amino acids 25 to 479 (455 residues), 457.6 bits, E=2e-141

Best Hits

Swiss-Prot: 100% identical to PHNY_RHIME: Phosphonoacetaldehyde dehydrogenase (phnY) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00155, [EC: 1.2.1.-] (inferred from 100% identity to sme:SM_b21539)

MetaCyc: 100% identical to phosphonoacetaldehyde dehydrogenase (Sinorhizobium meliloti 1021)
1.2.1.-

Predicted SEED Role

"NAD-dependent aldehyde dehydrogenases"

MetaCyc Pathways

• 2-aminoethylphosphonate degradation II (2/2 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Arginine and proline metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine biosynthesis
• Naphthalene and anthracene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.-

Sequence Analysis Tools

See Q92UV7 at UniProt or InterPro

Protein Sequence (485 amino acids)

>SM_b21539 aldehyde dehydrogenase (Sinorhizobium meliloti 1021)
MTNAEVTIAVRHEPMRIAGRLVDTDDRVEVRYPWNDTVVGTVPAGRAEHAREAFAIAAAY
QPKLTRYERQKILLATAEALAARKEEISDVITLELGISKADSLYEVGRAFDVFTLAGQMC
IRDDGEIFSCDLTPHGKARKIFTMREPLTAISAITPFNHPLNMVAHKVAPAIATNNCVVV
KPTELTPMTALLLADILYEAGLPPEMLSVVTGWPADIGMEMITNPHVDLVTFTGSVPVGK
LIAANAHYKRQVLELGGNDPLIILNDLSDDDLARAADLAVAGATKNSGQRCTAVKRILCQ
ESVADRFVPLVLERAKRLRFGDPMDRSTDLGTVIHEKAAALFEERVMRAAEEGADILYHP
GRSGALLPPIVVDRVPHQSDLVLEETFGPIIPIVRVPDDDDATITLSNSTAFGLSSGVCT
NDYRRMQKYIAGLKVGTVNIWEVPGYRIEMSPFGGIKDSGNGYKEGVIEAMKSFTNVKTF
SLPWP