Protein Info for SM_b21536 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 176 to 202 (27 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 281 to 305 (25 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 16 to 151 (136 residues), 108.9 bits, see alignment E=2.1e-35 amino acids 165 to 255 (91 residues), 40.4 bits, see alignment E=3.1e-14 PF01895: PhoU" amino acids 350 to 427 (78 residues), 36.2 bits, see alignment E=6.5e-13

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 100% identity to sme:SM_b21536)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UW0 at UniProt or InterPro

Protein Sequence (556 amino acids)

>SM_b21536 hypothetical protein (Sinorhizobium meliloti 1021)
MTLVALSLHLAGATVLLLYAVHLVRSGVENAYGTSLKRVLARGGERRIYAAASGTVLAVL
LQSSTAVAMLASGLSASGYLTLNTSLAVLLGADLGSALVVRVLSFDLGWLSPLLLAAGGL
LYLKGRSDKPRELGRMLLGIGFVLMSLKLIGEATLPLKQSDVLPAVVGYLAKDQVTAFAA
AMLFTWIVHSSVAVLILILGFAAQGLLPVEAGLPLILGANLGSGLIAMWLTRGFSAEARR
VAAGNLLFRAFGAAIALLVIGPFSAELQHLGATAAEQLVHFHLAFNACLVIFCLPLSQLA
ASAVTSLIKSDLKSSEDSDTLARRISALDQALLDSPDAALAAATREVLFMGEVVERMLCP
VMELLEHPTPAKIEEIRRLDGYVNRAHRDIKLYLAAIHRGVLDERQSRRGVELIDIAINL
EHAGDIVSKTLVEIARDKLENGNNFSDEGWTELKALHASVRDNMRLAFNLLVSDDPVMAR
KLVREKERVRALVRESHERHLARLRAGRAESVESSNMHLEVARALKEVNSLLATLAYPIL
KQRGDLLESRLALVKG