Protein Info for SM_b21531 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 93 to 122 (30 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 23 to 318 (296 residues), 198.7 bits, see alignment E=5.8e-63

Best Hits

Swiss-Prot: 100% identical to Y5671_RHIME: UPF0324 membrane protein RB0971 (RB0971) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4740)

Predicted SEED Role

"Probable sulfate exporter tauZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UW5 at UniProt or InterPro

Protein Sequence (345 amino acids)

>SM_b21531 hypothetical protein (Sinorhizobium meliloti 1021)
MDAISKTERRKQSLSVVLSTYGPGLLVTAAVAMAAQFLSEHYGAPAMLMALLLGIAFHFL
AEEGRCVAGIELSAKLVLRIGVALLGMRISVDLLIGLGGGTILLLVSAIVATILFGLVAA
RLLGRGWRLALLTSGAVAICGASAAMAIAAVLPRNEFSERNLIFTVLSVTVLSTLAMIGY
PIVAEYLGLDGQATGIFFGGTIHDVAQVVGAGFSVSPEAGETATLVKLIRVTMLAPVVLI
FSLVLRSVPQEGASIGKRAPLVPGFVLAFLVLAGFNSAGLVPVLASEVGMAISRWALLAG
IVAVGMKTSLRRVLEVGGDAVALVVAETLFIAVFILAGMYYLGHS