Protein Info for SM_b21528 in Sinorhizobium meliloti 1021

Annotation: taurine uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 99 to 268 (170 residues), 104.8 bits, see alignment E=2.3e-34

Best Hits

Swiss-Prot: 54% identical to TAUC_ECOLI: Taurine transport system permease protein TauC (tauC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to sme:SM_b21528)

MetaCyc: 54% identical to taurine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UW9 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SM_b21528 taurine uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MLEGVAKSKPVRPGRIYGAPGDGMSGHISLLTALAFIALWLLVTEMGWIKPLFLPSPLAV
WDKFVIALTEGVSNSTLAQHTLASLGRVLGAFLLALVTAVPVGILMGVNRVVRGLFDPII
EFYRPLPPLAYLPLIIIWLGIGEFPKVFLIYLAIFAPMAIAARAGVRSVSTEQIHAAYAM
GATRAQVIGHVILKAALPEIFTGMRIGIGVGWTTLVAAEMVAAHRGLGFMVLNAAEYLAS
DTVIMGIVVIGVFAFAFDLMIRYLEKALIPWKGKV