Protein Info for SM_b21527 in Sinorhizobium meliloti 1021

Annotation: taurin uptake ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 25 to 165 (141 residues), 102 bits, E=2.2e-33

Best Hits

Swiss-Prot: 100% identical to TAUB_RHIME: Taurine import ATP-binding protein TauB (tauB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to smk:Sinme_4745)

MetaCyc: 51% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine transport ATP-binding protein TauB" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

See Q92UX0 at UniProt or InterPro

Protein Sequence (270 amino acids)

>SM_b21527 taurin uptake ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
METLNVSNVSLTYPGLYSDQAVIALKGVNLEIKSGDFVVALGASGCGKTTLLNLMAGFMA
PSDGEIMLGDRRITGPGADRGVVFQKHALLPWLNVIDNTEFGLKLRGVDKATRRDLATRN
LALVGLQDFHRHMIYHLSGGMQQRVGIARALTCDPAMLLMDEPMAALDALTRETIQELLL
EVWQLTNKMFFFITHSVEEALFLGSRLIVMSPRPGRITHTYELDFNKRFLENGNARAIKS
SRDFIDMREEILGIIYGDELQSGNPELLHA