Protein Info for SM_b21524 in Sinorhizobium meliloti 1021

Annotation: septum formation inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR01222: septum site-determining protein MinC" amino acids 28 to 248 (221 residues), 151 bits, see alignment E=2.2e-48 PF03775: MinC_C" amino acids 145 to 244 (100 residues), 102.7 bits, see alignment E=4.9e-34

Best Hits

Swiss-Prot: 100% identical to MINC_RHIME: Probable septum site-determining protein MinC (minC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03610, septum site-determining protein MinC (inferred from 100% identity to sme:SM_b21524)

Predicted SEED Role

"Septum site-determining protein MinC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TY9 at UniProt or InterPro

Protein Sequence (249 amino acids)

>SM_b21524 septum formation inhibitor (Sinorhizobium meliloti 1021)
MTKVLTDARSIRIKGRSFLALVLSPELPLDWWLGRLDDLASRSAGFFLGRPVVLDVADLE
IDRKQLKSLLDELGQRNVRVMGIEGGRPSLFEPGMPPAMKGGRPAPDFEVPEVDPADPPK
AGKGKAAAPITPEEVQPVRATASIIVREPVRSGQSVIFPEGDVTVVGSVASGAEIVAGGS
VHIYGTLRGRALAGSVGNASARIFCRRLEAELLAIDGVYKTAEDMAPNLRGQSVQLWLEG
DSIMAERLN