Protein Info for SM_b21514 in Sinorhizobium meliloti 1021

Annotation: modification methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR00536: methyltransferase, HemK family" amino acids 52 to 259 (208 residues), 151.5 bits, see alignment E=1.3e-48 PF11599: AviRa" amino acids 72 to 135 (64 residues), 26.8 bits, see alignment E=1.7e-09 PF02384: N6_Mtase" amino acids 84 to 172 (89 residues), 22.2 bits, see alignment E=4.1e-08 PF06325: PrmA" amino acids 88 to 166 (79 residues), 26.1 bits, see alignment E=2.9e-09 PF13847: Methyltransf_31" amino acids 89 to 224 (136 residues), 36.4 bits, see alignment E=2.3e-12 PF05175: MTS" amino acids 89 to 183 (95 residues), 40.4 bits, see alignment E=1.2e-13 PF09445: Methyltransf_15" amino acids 90 to 169 (80 residues), 27.7 bits, see alignment E=9.1e-10 PF13649: Methyltransf_25" amino acids 91 to 166 (76 residues), 35.5 bits, see alignment E=6.7e-12 PF01170: UPF0020" amino acids 106 to 170 (65 residues), 32 bits, see alignment E=4.9e-11

Best Hits

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to smk:Sinme_4392)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TZ9 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SM_b21514 modification methylase (Sinorhizobium meliloti 1021)
MLSDALHFSFRLPARASVRRTTSNPITEGAFVLQGDNHLDGRTEGRSPRLVRFMGVDLEL
APDVLVPREETELLGRNAAAILTERAGPATVIDMCCGSGNLALGIAEEVPLARVWGADLT
DSTVALARRNVDRLSLGDRVVIRQGDLFTALAGEDLEGAVDMIVCNPPYISTSRLEGDSA
HLLASEPREAFDGGPYGISIHQRLIREAVAFLKPGGWLLFEFGEGQDRQATALLARTKAY
EAVTFAEDSAGKPRVALARRLGGAAATAAADGASR