Protein Info for SM_b21513 in Sinorhizobium meliloti 1021

Annotation: cell-surface polysaccharide exporter protein PST family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 304 to 328 (25 residues), see Phobius details amino acids 336 to 360 (25 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details PF01943: Polysacc_synt" amino acids 30 to 268 (239 residues), 44.6 bits, see alignment E=1.3e-15 PF13440: Polysacc_synt_3" amino acids 42 to 338 (297 residues), 37.1 bits, see alignment E=2.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21513)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U00 at UniProt or InterPro

Protein Sequence (436 amino acids)

>SM_b21513 cell-surface polysaccharide exporter protein PST family (Sinorhizobium meliloti 1021)
MAPEGVTEQRGDRPFLPMVVSYLASGGSLVLGSAAQLLTFAILARWLGVHEFSVFVAITA
VANIAVHLCGLGAMECLVRRVARDRAIYPQMLGHNVILTAASGAALVLLGAVVLPFFFTL
SPDPVTNVAVITLMLVTNILLVRVIVLTEQIYIAHTDFASANKVVVGFAAARTVAAALAC
IAFGVTSVAYWAVWQFLCHVLVALLCMRAIRGLGTPRYRIVREEIPQGLYFSIPFILRAL
RQNADLLVLSLVTTAEVVASYSVARRMLESSYLSVEALNRLIYPGSARATAAGLHQALQR
VRRVLAAATVISLAAAVTVFVLAPVLPYLFGKDYLSLVGFVRILCWVVVPLAMWSVAVEA
LGASGAHAARATVMGLGSIAGAGLAVWASWYAPPMGTFLSFYAIEIAMVVASWSVLLHFV
RRDRRQAALTFGAGVI