Protein Info for SM_b21507 in Sinorhizobium meliloti 1021

Annotation: amino acid transporter, exporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 66 (26 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details PF01810: LysE" amino acids 22 to 209 (188 residues), 104.6 bits, see alignment E=2.4e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21507)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U06 at UniProt or InterPro

Protein Sequence (218 amino acids)

>SM_b21507 amino acid transporter, exporter protein (Sinorhizobium meliloti 1021)
MPDLTTYAAFLGAVLAYQLSGVGPDMMLVISRGIGQGRQAALATAIGCVAAGIVQVPLLA
MGLATVVASSPLLYKAMQFIGAAYLIYVGVRFLTAGSKTFLREAAGRATSPSLLGPFRQG
MICNLTNPTSLSFMLAILPQFVEPSAGSPALQFFILGVTMKATGLLVLGAVALTSGTFSN
WLSHSSAFVAWQQRIAGSIMVALGIRLLLSPVAPALHR