Protein Info for SM_b21502 in Sinorhizobium meliloti 1021

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 37 to 198 (162 residues), 77.9 bits, E=2.4e-25
• PF13579: Glyco_trans_4_4
  • amino acids 37 to 193 (157 residues), 73.7 bits, E=5.4e-24
• PF00534: Glycos_transf_1
  • amino acids 213 to 356 (144 residues), 76.5 bits, E=4.6e-25
• PF20706: GT4-conflict
  • amino acids 214 to 320 (107 residues), 30.3 bits, E=5.6e-11
• PF13692: Glyco_trans_1_4
  • amino acids 215 to 350 (136 residues), 77.2 bits, E=4e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21502)

Predicted SEED Role

"Alpha-D-GlcNAc alpha-1,2-L-rhamnosyltransferase (EC 2.4.1.-)" in subsystem Rhamnose containing glycans (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See Q92U11 at UniProt or InterPro

Protein Sequence (389 amino acids)

>SM_b21502 glycosyltransferase (Sinorhizobium meliloti 1021)
MPGGATASMPASVYRELPIERRRVMMLGLRGIPNVQGGVEKHVEMLAGRLIAHGWDVEVV
GRRRYLAVPAPHSWNGIRVTPLWSPRMMALEAIVHTFLGVCYAALRRPDILHIHAVGPAL
LVPLARLMRLNVVVTHHGYDYDRQKWGAFARRMLRAGERMGMRLAQGRIAISRDIADTMG
ERYRVPVSLVPNGVTVSRSSSETGILGEFRLTRRRYILLAARLVPEKRQIDLIQAYAKLG
NSGFDLVLAGGAEFAGVYEEEVRALASRVPGVVLTGFQTGDRLAELFANAALFVLPSSHE
GMPIALLEAMAHGLPVLASDIVANRQLGLPAGDYFPLGNVDALSSAIAEKIANPPDEQEV
LAQTERVEAVYSWSSVALKTLDVYRAVTK