Protein Info for SM_b21497 in Sinorhizobium meliloti 1021

Annotation: acriflavin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 37 to 365 (329 residues), 269.5 bits, see alignment E=1.6e-84 PF25917: BSH_RND" amino acids 60 to 191 (132 residues), 56.9 bits, see alignment E=4e-19 PF25876: HH_MFP_RND" amino acids 100 to 169 (70 residues), 38.9 bits, see alignment E=2.2e-13 PF25944: Beta-barrel_RND" amino acids 205 to 289 (85 residues), 47.6 bits, see alignment E=4.8e-16 PF25954: Beta-barrel_RND_2" amino acids 227 to 290 (64 residues), 28.6 bits, see alignment E=3.4e-10 PF25967: RND-MFP_C" amino acids 295 to 355 (61 residues), 56.6 bits, see alignment E=5.1e-19

Best Hits

Swiss-Prot: 34% identical to ACRE_ECOLI: Multidrug export protein AcrE (acrE) from Escherichia coli (strain K12)

KEGG orthology group: K03585, membrane fusion protein (inferred from 100% identity to smk:Sinme_4407)

MetaCyc: 34% identical to multidrug efflux pump membrane fusion lipoprotein AcrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-367

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U16 at UniProt or InterPro

Protein Sequence (373 amino acids)

>SM_b21497 acriflavin resistance protein (Sinorhizobium meliloti 1021)
MRVSRVLAAALSCGLLTTIGIVAGNAYAQQPPPAVNVAPAAIMDLRESVDLTGKVVAVQK
VDIRARVSGFLEKVNFEDGQKVSAGTVLYQVEDGAYRAALQEIDGSIAAAEAQRDLAVLE
RDRAQRLIATNTVAQATLDTANAQVKKAEADILRLKGSKQNAELNLSYTKILAPFDGVVG
LTTVDVGALVAPDSGSLVTLTRLDPIYVEFPVATSLYFSYRERVEKGEMSSGANVSITLP
NGTDYPEKGTIDFVASTVSQGTDTVTVRAEFPNPGGTLLDGTLVRVVLEQSDPQDVLAVP
QQAVQRDQQGAFVMVVDANSKVELRRVDVSRSSRGQAVVAKGLKEGENVITEGVGKVRPG
IVVDAVAATTTGG