Protein Info for SM_b21494 in Sinorhizobium meliloti 1021

Annotation: ornithine cyclodeaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF02423: OCD_Mu_crystall" amino acids 18 to 320 (303 residues), 441.2 bits, see alignment E=9e-137

Best Hits

Swiss-Prot: 74% identical to OCD_BRUSU: Ornithine cyclodeaminase (ocd) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 100% identity to sme:SM_b21494)

MetaCyc: 71% identical to ornithine cyclodeaminase (Agrobacterium tumefaciens)
Ornithine cyclodeaminase. [EC: 4.3.1.12]

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12)" in subsystem Arginine and Ornithine Degradation (EC 4.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.12

Use Curated BLAST to search for 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U20 at UniProt or InterPro

Protein Sequence (355 amino acids)

>SM_b21494 ornithine cyclodeaminase (Sinorhizobium meliloti 1021)
MFSPLPSAKAMVPFVSVDNMMRLVHHLGIETVLAELTDTIEADFRRWESFDKTPRVASHS
RDGVIELMPTSDGRVYSFKYVNGHPKNTAEGLQTVTAFGLLAEVSTGYPALLTEMTILTA
LRTAATSAMAARHLAPKGARTMAMIGNGAQAEFQALAMKAVCGIDTIRLYDIDPRATEKA
ARNLDGSGLKILSCRSAQEAIEGAEIVTTCTADKQFATILTDNMVGAGVHINAIGGDCPG
KTELHRDILQRSDVFVEYPPQTRIEGEIQQMAPDFPVTELWKVVTGEAQGRRDGRQITLF
DSVGFAIEDFSALRYVRARLPGTDFYQNLDMIADPDDPRDLFGMLLRAKENEETI