Protein Info for SM_b21489 in Sinorhizobium meliloti 1021

Annotation: cytochrome O ubiquinol oxidase subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02842: cytochrome o ubiquinol oxidase, subunit III
  • amino acids 30 to 209 (180 residues), 272.3 bits, E=1.3e-85
• PF00510: COX3
  • amino acids 31 to 207 (177 residues), 57.6 bits, E=9.2e-20

Best Hits

Swiss-Prot: 59% identical to CYOC_ECOL6: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 100% identity to sme:SM_b21489)

MetaCyc: 59% identical to cytochrome bo3 subunit 3 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

See Q7ANN3 at UniProt or InterPro

Protein Sequence (210 amino acids)

>SM_b21489 cytochrome O ubiquinol oxidase subunit III (Sinorhizobium meliloti 1021)
MTEFHTERALDEGQAPAFYLTEEHHPEGSTMLGFWLYLMSDCLIFAVLFATHAVLGRNYA
AGPSPADLFDLPLVAVNTSMLLFSSITYGFAMLAMERYEKKATLTWMAVTALFGIAFVGL
EFYEFAHLLHEGAGPQRSAFLSSFFTLVGTHGLHVTAGIVWMFVLMAQVAKRGLIPENKR
RLMCLSMFWHFLDVVWIGVFSFVYLMGVLG