Protein Info for SM_b21487 in Sinorhizobium meliloti 1021

Annotation: cytochrome o ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 27 to 29 (3 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 12 to 245 (234 residues), 362.3 bits, see alignment E=4.3e-113 PF00116: COX2" amino acids 158 to 226 (69 residues), 27.8 bits, see alignment E=2e-10 PF06481: COX_ARM" amino acids 245 to 290 (46 residues), 68.7 bits, see alignment 3e-23

Best Hits

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to sme:SM_b21487)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U27 at UniProt or InterPro

Protein Sequence (386 amino acids)

>SM_b21487 cytochrome o ubiquinol oxidase subunit II (Sinorhizobium meliloti 1021)
MPELLKFSRRLAVLPLFLVMAGCDMVVMSPSGDIAAQQRDLIVISTILMLLIIVPVVFLT
LFFAWRYRRSNTSATYDPEWHHSTALEVVIWSAPLAIIIALGAITWISTHKLDPYRPLDR
LDAERAIPADARPLTVEVVALDWKWLFFYPDLGVAAVNELAAPVDVPIHFKITASSVMNS
FYIPALAGQIYAMPGMETKLHAVINKPGEYEGFSANYSGDGFSHMRFKFHGLDRQGFDDW
VARVKAQGTALNRDAYLKLEKPSEREPVRYYAAVEDGLYRAILNLCVTPGKMCMEEMMHI
DMMGGAGKESAENREKLEYDNRHSLAEGAPAATHPATGTPARSQQEPQGTGAEEPMQHDM
PMGGHEGHSMPGMNHQSDPAPPQLNH