Protein Info for SM_b21458 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 82 to 107 (26 residues), see Phobius details amino acids 118 to 145 (28 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 195 to 220 (26 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 278 (181 residues), 69.2 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 40% identical to SUGB_MYCTU: Trehalose transport system permease protein SugB (sugB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to sme:SM_b21458)

MetaCyc: 40% identical to ABC-type trehalose transporter integral membrane protein (Mycobacterium tuberculosis H37Rv)
7.5.2.-

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U55 at UniProt or InterPro

Protein Sequence (291 amino acids)

>SM_b21458 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MTVSAVTTRRYSNATYRTLRRVKTAGLYAGVAAVLVYMLFPYYWAIVSSTKTGQALYQFT
LLPALDFSNYRQLFDNPVFMGALVNSGVVALVSTAVSLVIGILAAYALGRLHFPPGRIVL
IAVLMISVFPQVVVLSGMFEVIGWLGLYNRPSALIVSYLILTLPFTTWILTSFIRDLPNE
LEEAALIDGCSRLRILTHVLLPLMGPAIASTGLLSFILAWNEFLFALTFILTDENRTVPV
AIGLLTGSSRYEYPFGQIMAASVTVTLPLLVLVLIFQRKIVAGLTSGAVKG