Protein Info for SM_b21448 in Sinorhizobium meliloti 1021

Annotation: DNA polymerase related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 141 to 158 (18 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details TIGR03914: uracil-DNA glycosylase family domain" amino acids 15 to 208 (194 residues), 290.6 bits, see alignment E=9.2e-91 TIGR00758: uracil-DNA glycosylase, family 4" amino acids 32 to 191 (160 residues), 137.1 bits, see alignment E=4.8e-44 PF03167: UDG" amino acids 46 to 205 (160 residues), 126.4 bits, see alignment E=4.8e-41

Best Hits

KEGG orthology group: K02334, DNA polymerase bacteriophage-type [EC: 2.7.7.7] (inferred from 100% identity to smk:Sinme_4455)

Predicted SEED Role

"Uracil-DNA glycosylase, putative family 6"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U62 at UniProt or InterPro

Protein Sequence (213 amino acids)

>SM_b21448 DNA polymerase related protein (Sinorhizobium meliloti 1021)
MPKQLAKLGPALAGEHAEATTIASLRRQAEGCERCDLYKNATQLVFGEGPVDARVVLVGE
QPGDREDLAGRPFVGPAGRILDECLHEAGIDRSECYLTNAVKHFKFEQRGKRRMHSRPNA
GEIQACAWWLGAELDELRPEIVVALGATALMSLLGRSVGVTRNRGQLLTAPGGFSVLVTI
HPSYLLRIRGRSDPEAERARFVDDLAKVATRIG