Protein Info for SM_b21436 in Sinorhizobium meliloti 1021

Annotation: C4-dicarboxylate transport system, permease large protein transmembrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 49 to 72 (24 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 315 to 346 (32 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 397 to 422 (26 residues), see Phobius details PF06808: DctM" amino acids 9 to 417 (409 residues), 390.3 bits, see alignment E=5.1e-121 TIGR00786: TRAP transporter, DctM subunit" amino acids 21 to 421 (401 residues), 387.6 bits, see alignment E=3.1e-120

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21436)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U73 at UniProt or InterPro

Protein Sequence (426 amino acids)

>SM_b21436 C4-dicarboxylate transport system, permease large protein transmembrane (Sinorhizobium meliloti 1021)
MSLALLVLFAVFILLLLIDAPIAIALALSSVAYLLVGDVLPLMVVAQRMVAGIDSFTLLA
IPLFLLAGLLMVHGGLAPRIVNLCAAVVGQRTGGLAIVMIAACMMFGSLSGSGVADVVAI
GSMLLPAMKERGYHPGFSAAGLGCAGSLGTVIPPSIVLIVYGTATGTSIGQLFIHSIGPG
ILLGFGLMVVAWWISRKNGWKGGEPFSWTRLGTALRESVLALLAPVIIVGGIRFGIFTPT
EAAGIGVAYALLVGALIYRQLTLAKVFSLLRDTTEMTGSILIVIAAASVFGWILTVEQVP
QLVVNAITGATESATVALMLMMVAVLVLGTFMESIAIILILAPVFLPVLRVFEIDPVYFG
VLLTINLAIGANTPPLGIDLMAACRTGGIPMSASFRYLLPFIGVMALIMFLLVLFPGLMT
LMSLGM