Protein Info for SM_b21430 in Sinorhizobium meliloti 1021

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details PF01032: FecCD" amino acids 36 to 348 (313 residues), 274.7 bits, see alignment E=4.5e-86

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to sme:SM_b21430)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U79 at UniProt or InterPro

Protein Sequence (356 amino acids)

>SM_b21430 iron ABC transporter permease (Sinorhizobium meliloti 1021)
MMAAVAEGIAGIEGRGRYRALVFRRLVMLSGLVAALFVSVAVDMALGPANYPLSDVLTAL
FHAETVSDQLRVVIWDIRMPIALMAVTVGASLSLAGAQMQTILANPLASPFTLGISAAAG
FGAALGLVAGVAVFPVAVQYMVPVNAFLMAMVAALFIHFASTMRGVTVETIVLLGIALVF
TFNAALSLLEYLASEQALAAVVFWTMGSLTKATWPKVWVTGAVLLVAVPVFARRAWALTA
LRLGEDKAASFGINVRRLRLETMLTVSLLAAIPVSFVGTIGFVGLVGPHIARMLVGEDQR
FFLPASVLCGALLLSVTSVVSKMLIPGAVLPIGIITALVGVPFFFVLIFTNRKRAW