Protein Info for SM_b21427 in Sinorhizobium meliloti 1021

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF00132: Hexapep" amino acids 108 to 142 (35 residues), 29.8 bits, see alignment 3.6e-11 PF14602: Hexapep_2" amino acids 110 to 140 (31 residues), 29.3 bits, see alignment 5.6e-11

Best Hits

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_4471)

Predicted SEED Role

"Galactoside O-acetyltransferase (EC 2.3.1.18)" in subsystem Lactose utilization (EC 2.3.1.18)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U82 at UniProt or InterPro

Protein Sequence (162 amino acids)

>SM_b21427 acetyltransferase (Sinorhizobium meliloti 1021)
MIEVHPSAKISPLCDIEDSVRGTRIVVGEASVIDSFVKVKPVGGTGDLTIGRFCYVNSGC
VFYTGNGISIADNVLIAANCTFAPVNHAYGDRDRLIREQGFLPSRGGILVEEDVWIGANS
VILDGALLRKGCVIAAGSIVRGEVEAYTVCGGNPLRRLGVRS