Protein Info for SM_b21423 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 58 to 318 (261 residues), 129.4 bits, see alignment E=7.2e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SM_b21423)

Predicted SEED Role

"putative sugar uptake ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U86 at UniProt or InterPro

Protein Sequence (331 amino acids)

>SM_b21423 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MPDNLQSETLPMADLERNRNRAAIRRAPESAALLAFLVAEIIFFSLSSPYFLTWGNWVNV
FTALSITGVLAAGGTMLLIAGQFDLSVGSGVAFVALVLALTIDSLGVLPASVLAMLVGVG
IGLINGFLVTRIGVNALITTLGTLAIFRGLTQSIGGGRNIPIANFDWAIWRPFLNIPLSA
LVFLLVAIMVGIVLKRSVFGRSIYAIGANENAARLVGIRTKGVVFAGFLLSGAFIGLGGL
ISASQLGSTSGTTGLGLELAVVTAVILGGTSLKGGTGTMLGTVIGLLIVGVLNNGLTLMN
VNSSWQQAATGLLLILAVSFDQLRQRLVGRR