Protein Info for SM_b21418 in Sinorhizobium meliloti 1021

Annotation: NDP-hexose 3-C-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF08421: Methyltransf_13" amino acids 5 to 67 (63 residues), 73.8 bits, see alignment E=2.6e-24 PF13489: Methyltransf_23" amino acids 86 to 240 (155 residues), 56.5 bits, see alignment E=7.2e-19 PF08242: Methyltransf_12" amino acids 105 to 196 (92 residues), 33.3 bits, see alignment E=1.6e-11 PF08241: Methyltransf_11" amino acids 106 to 197 (92 residues), 23.4 bits, see alignment E=1.9e-08 PF08484: Methyltransf_14" amino acids 247 to 405 (159 residues), 203.1 bits, see alignment E=6.2e-64

Best Hits

Swiss-Prot: 38% identical to NOVU_STRNV: C-methyltransferase NovU (novU) from Streptomyces niveus

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21418)

MetaCyc: 36% identical to D-olivose 4-ketoreductase (Streptomyces argillaceus)
2.1.1.-; 1.1.1.-

Predicted SEED Role

"FIG01163484: hypothetical protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U91 at UniProt or InterPro

Protein Sequence (410 amino acids)

>SM_b21418 NDP-hexose 3-C-methyltransferase (Sinorhizobium meliloti 1021)
MSHSCRFCSTPLETVVADLGATPWSNSFLEPTEEAIAREKAFPLKVMVCSECLLVQTTET
VPADEIFNADYHYLSSFSTSWLDHARRYAEAMAERFALDGRSQVVEVASNDGYLLQYFAA
KRIPVLGVEPAANAARIAEGRNVPTHVAFFGRDTANALVARGVRADLTAANNVLAHVPDI
ADFVSGFAILLKPDGVATFEFPHLLRLIEGIQFDTIYHEHYSYLSLAAVERIFAACGLKV
FDVEELPTHGGSLRVYAQPVTGTRPATETLAEVRAEEESAGLTQMPTYAAFGKRIASVCD
GFRAFLADARSENKRVAAYGAAAKGNTFLNVCGLTASDIDFIVDRNDLKQGKLSPGSHIP
IYDPARIEAVKPDYVVILPWNLTDEIVAAHAYIRSWGGRFVVAIPQVRVI