Protein Info for SM_b21414 in Sinorhizobium meliloti 1021
Annotation: amino acid decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01618, [EC: 4.1.1.-] (inferred from 100% identity to sme:SM_b21414)Predicted SEED Role
"Aromatic-L-amino-acid decarboxylase (EC 4.1.1.28)" in subsystem Aromatic amino acid degradation or Auxin biosynthesis (EC 4.1.1.28)
MetaCyc Pathways
- betaxanthin biosynthesis (via dopamine) (2/2 steps found)
- betaxanthin biosynthesis (2/3 steps found)
- L-dopa degradation II (bacterial) (1/2 steps found)
- octopamine biosynthesis (1/2 steps found)
- L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
- salidroside biosynthesis (2/4 steps found)
- L-tryptophan degradation VI (via tryptamine) (1/3 steps found)
- phenylethanol biosynthesis (2/5 steps found)
- catecholamine biosynthesis (1/4 steps found)
- serotonin and melatonin biosynthesis (1/4 steps found)
- L-phenylalanine degradation IV (mammalian, via side chain) (4/9 steps found)
- hydroxycinnamic acid tyramine amides biosynthesis (1/5 steps found)
- beta-carboline biosynthesis (1/6 steps found)
- hydroxycinnamic acid serotonin amides biosynthesis (1/6 steps found)
- psilocybin biosynthesis (1/6 steps found)
- indole-3-acetate biosynthesis II (5/12 steps found)
- (S)-reticuline biosynthesis II (1/7 steps found)
- methanofuran biosynthesis (1/8 steps found)
- (S)-reticuline biosynthesis I (3/11 steps found)
- superpathway of betalain biosynthesis (13/27 steps found)
- secologanin and strictosidine biosynthesis (1/17 steps found)
- Amaryllidacea alkaloids biosynthesis (1/26 steps found)
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Alkaloid biosynthesis I
- Ascorbate and aldarate metabolism
- Benzoate degradation via hydroxylation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biphenyl degradation
- Fluorene degradation
- Histidine metabolism
- Indole and ipecac alkaloid biosynthesis
- Phenylalanine metabolism
- Phenylpropanoid biosynthesis
- Purine metabolism
- Pyruvate metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 4.1.1.-
Use Curated BLAST to search for 4.1.1.- or 4.1.1.28
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92U95 at UniProt or InterPro
Protein Sequence (473 amino acids)
>SM_b21414 amino acid decarboxylase (Sinorhizobium meliloti 1021) MKEETTREILQCAAEHAARFREKITELPQRPELSYPAALETFRETLPERGSAGSEVIGEL AAKAEPGLHAMTGPRFFGWVIGGSHPVGVAADWMTSAWGQNAGNHHAAPAAAAAEAIAAN WLLDLLDLPRESSVGFATGATLANFICLAAARGEVLRQAGWDVEAQGLFGAPPVVVLIGD DAHATVFSALQFLGFGHDRVLRVQTDDMGRITGPAFAGAAAQVSGPCIAILQAGQINTGA FDDFAGMMPIARGLGAWVHVDGAFGLWARATPGKRGLTDGIDEAHSWATDGHKWLQTPYD CGYAIIRDQEAHRRAMTIAASYLPPTTEGERDPSHFVPELSRRARGFATWAMIKHLGREG IAAMVDRHCRVARAIAQRLSREDGINVLNEVALNQVLVRFGAAMPGEEGDRLTQATTARL QADGILFAGGAVWRGRRVMRMSVISWLTDDRAGEVAAGAIIAAWRAVRDGTEV