Protein Info for SM_b21414 in Sinorhizobium meliloti 1021

Annotation: amino acid decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF00282: Pyridoxal_deC" amino acids 42 to 397 (356 residues), 140.8 bits, see alignment E=2.6e-45

Best Hits

KEGG orthology group: K01618, [EC: 4.1.1.-] (inferred from 100% identity to sme:SM_b21414)

Predicted SEED Role

"Aromatic-L-amino-acid decarboxylase (EC 4.1.1.28)" in subsystem Aromatic amino acid degradation or Auxin biosynthesis (EC 4.1.1.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U95 at UniProt or InterPro

Protein Sequence (473 amino acids)

>SM_b21414 amino acid decarboxylase (Sinorhizobium meliloti 1021)
MKEETTREILQCAAEHAARFREKITELPQRPELSYPAALETFRETLPERGSAGSEVIGEL
AAKAEPGLHAMTGPRFFGWVIGGSHPVGVAADWMTSAWGQNAGNHHAAPAAAAAEAIAAN
WLLDLLDLPRESSVGFATGATLANFICLAAARGEVLRQAGWDVEAQGLFGAPPVVVLIGD
DAHATVFSALQFLGFGHDRVLRVQTDDMGRITGPAFAGAAAQVSGPCIAILQAGQINTGA
FDDFAGMMPIARGLGAWVHVDGAFGLWARATPGKRGLTDGIDEAHSWATDGHKWLQTPYD
CGYAIIRDQEAHRRAMTIAASYLPPTTEGERDPSHFVPELSRRARGFATWAMIKHLGREG
IAAMVDRHCRVARAIAQRLSREDGINVLNEVALNQVLVRFGAAMPGEEGDRLTQATTARL
QADGILFAGGAVWRGRRVMRMSVISWLTDDRAGEVAAGAIIAAWRAVRDGTEV