Protein Info for SM_b21410 in Sinorhizobium meliloti 1021

Annotation: methyltransferase, S-adenosyl-L-methionine (SAM)-MTase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF13489: Methyltransf_23" amino acids 46 to 215 (170 residues), 37.3 bits, see alignment E=1e-12 PF01209: Ubie_methyltran" amino acids 50 to 158 (109 residues), 56.5 bits, see alignment E=1.2e-18 PF01135: PCMT" amino acids 50 to 102 (53 residues), 21.8 bits, see alignment 6.5e-08 PF07021: MetW" amino acids 57 to 152 (96 residues), 22.2 bits, see alignment E=4.4e-08 PF13847: Methyltransf_31" amino acids 59 to 172 (114 residues), 64.2 bits, see alignment E=5.5e-21 PF13649: Methyltransf_25" amino acids 63 to 155 (93 residues), 81.3 bits, see alignment E=3.1e-26 PF08241: Methyltransf_11" amino acids 64 to 158 (95 residues), 87.6 bits, see alignment E=3.3e-28 PF08242: Methyltransf_12" amino acids 64 to 157 (94 residues), 56.7 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21410)

Predicted SEED Role

"Small Molecule Metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U99 at UniProt or InterPro

Protein Sequence (289 amino acids)

>SM_b21410 methyltransferase, S-adenosyl-L-methionine (SAM)-MTase (Sinorhizobium meliloti 1021)
MMRAALATPLHRSRLPLAAKGALMTSSFNVHDAAGYEQLMGRWSRKLAPKFIDFAGVADG
EKVLDVGCGTGSLTFALADAARLKEIAAIDYSPVFVEEATRRNTNPRIKIREADACALPF
EDRTFDRAFALLVLHFVPEAGKAVAEMRRVVRPGGVVAAAVWDHLGGMPGMRMMVDTVAA
LSEGGRRLRARYCFQPMMQPGEMKRTFVEQGLANITESELMIRMDYGNFDDYWAPIGAGE
GPLGKYVATLDAEERARTGAAVRDAYEAGRPDGPRSFANVAWVCRGTVP