Protein Info for SM_b21406 in Sinorhizobium meliloti 1021
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to KU_RHOSK: Non-homologous end joining protein Ku (ku) from Rhodobacter sphaeroides (strain KD131 / KCTC 12085)
KEGG orthology group: K10979, DNA end-binding protein Ku (inferred from 100% identity to smk:Sinme_4490)Predicted SEED Role
"Ku domain protein" in subsystem DNA Repair Base Excision
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92UA3 at UniProt or InterPro
Protein Sequence (294 amino acids)
>SM_b21406 hypothetical protein (Sinorhizobium meliloti 1021) MAVSARAQWKGYLRFGEVTAPVALYTATSTSDRIAFHTVNRETGNRVRREFIDSVSGKPV EKEDQVKGYEIGDERYVVLEPEEVASAVPESDKTLRVQAFIPCDEVEKVYFDKPYYLTPD KMGTDAFALLREGMRKKKVAAIAQTVLFRRMRTILLRPHDKGLIATTLNFDYEVRSAKEA FKEIPDIKIEGEMLDLAKHIIGMKKGTFSAEEFDDRYEAALADLIKAKLEGKSLPKRAPP KVSKANDLLEALRQSAGMKKPPAASKKRAGKESAAKTKAKTAAKSAPAQRRRAS