Protein Info for SM_b21402 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF00353: HemolysinCabind" amino acids 5 to 39 (35 residues), 29.6 bits, see alignment 2.7e-11 amino acids 40 to 73 (34 residues), 31.6 bits, see alignment 6.5e-12 amino acids 77 to 111 (35 residues), 32.7 bits, see alignment 2.8e-12 amino acids 104 to 136 (33 residues), 27.9 bits, see alignment 9.3e-11 amino acids 156 to 181 (26 residues), 30.4 bits, see alignment (E = 1.6e-11) amino acids 182 to 215 (34 residues), 24.7 bits, see alignment 9.4e-10 amino acids 218 to 253 (36 residues), 32.7 bits, see alignment 3e-12 amino acids 236 to 271 (36 residues), 31.6 bits, see alignment 6.7e-12 amino acids 263 to 297 (35 residues), 36.2 bits, see alignment 2.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21402)

Predicted SEED Role

"ELEMENTS OF EXTERNAL ORIGIN; Colicin-related functions Non-bacterial functions"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UA7 at UniProt or InterPro

Protein Sequence (387 amino acids)

>SM_b21402 hypothetical protein (Sinorhizobium meliloti 1021)
MILNGTSLSDVIRGFLSDDQIWGYAGDDYLYGGVGNDRIFGGDGNDYIVGGVGDDYAEGG
EGNDRLDGGLGNDAFMGGIGNDIFDGGEGNDVLDGGHGHDQMLGGRGHDKIFGGAGEDYI
DADEGDDIIFAGSGDDGFNNRVNPATGKLTQQAVGGGAGNDTIYGEGGNDALKGQSGNDR
VYGGIGDDIVDGGNGNNYLDGGDGNDVLDSEGGSDEAHGGSGNDRISVGAGNDRAFGDDG
DDILTSGAGDDYLSGGIHQDRLFGGTGNDTLRGDAGRDVLSGDAGSDILWGGSDSDRFVF
KGLGALSGQDTVMDFQDGLDLLAIESLGVKQYSNSGAAGTIYAYDATGGDVLVKGYNSAG
NAFSILVDDPNGSLTAANFSRADFVFA