Protein Info for SM_b21368 in Sinorhizobium meliloti 1021

Annotation: cytochrome c oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 64 (25 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details PF00116: COX2" amino acids 134 to 211 (78 residues), 61.5 bits, see alignment E=1.1e-20 PF13442: Cytochrome_CBB3" amino acids 237 to 323 (87 residues), 33.8 bits, see alignment E=5.2e-12 PF00034: Cytochrom_C" amino acids 238 to 326 (89 residues), 53 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to smk:Sinme_4765)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UY8 at UniProt or InterPro

Protein Sequence (327 amino acids)

>SM_b21368 cytochrome c oxidase subunit II (Sinorhizobium meliloti 1021)
MRLARYFAAASALALQGCAGLQSALDPSGAEAERIGTLSWLLVLFSTAILVAVCLITAVA
LFGGERWRARIAGERIVIGGGLVFPILALSVLLIYGFYLMSPGTTEARSQGALRIEVVGE
RWWWRVTYVDEAGRRIESANEIRLPVGRPVELELTSADVIHSFWVPRLAGKLDMIPGHTN
TLTLQATKAGISRGQCAEYCGGPHAFMSFYVIAMPEDQFSSWLAGEAGDASAAKPDQAAG
QALFLSSGCAACHRVRGTDARGTIGPDLTHVGSRHSLAAATLENDVAAFVRWIRDGQHVK
PENLMPPFEIFTDDELRQLAAYLDQLR