Protein Info for SM_b21352 in Sinorhizobium meliloti 1021

Annotation: C4-dicarboxylate small membrane transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details PF04290: DctQ" amino acids 9 to 137 (129 residues), 112.9 bits, see alignment E=5.1e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21352)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V06 at UniProt or InterPro

Protein Sequence (165 amino acids)

>SM_b21352 C4-dicarboxylate small membrane transport protein (Sinorhizobium meliloti 1021)
MAGVGLVAMTLIVAWQVFCRYVLNDSPSWTEPGAVMLMSWFIFLGAAVGVRENYHLGFDV
LLYVVPKGGKIWLRMISDIVALAFGIGMIWYGGQLVALTWNTILPSLQISGGWSYVPLVA
GGVLICLFALERIVLRLAGEPIDDLLDEMPPAEVAAELETAEIRA