Protein Info for SM_b21345 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter substrate-binding protein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 40 to 309 (270 residues), 84.8 bits, see alignment E=1.1e-27 PF13407: Peripla_BP_4" amino acids 41 to 302 (262 residues), 185.5 bits, see alignment E=2.1e-58 PF13377: Peripla_BP_3" amino acids 174 to 305 (132 residues), 35.3 bits, see alignment E=1.9e-12

Best Hits

Swiss-Prot: 46% identical to YTFQ_ECOLI: ABC transporter periplasmic-binding protein YtfQ (ytfQ) from Escherichia coli (strain K12)

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 98% identity to smd:Smed_4740)

MetaCyc: 46% identical to galactofuranose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, periplasmic binding protein YtfQ precursor"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q926G7 at UniProt or InterPro

Protein Sequence (327 amino acids)

>SM_b21345 sugar uptake ABC transporter substrate-binding protein precursor (Sinorhizobium meliloti 1021)
MNRISRRAFMLAATAAGAIAIAGTVAFAELPKLAQKETYKVGFAQTESNNPWRIAQTNSM
KAEAEKLGHQLVYTDAAGSAAKQVADVNSMIAQGVDLIFLAPREEKPLIPAVMAAKKAGI
PVILLDRSVDPSLAKAGEDYVTFIGSDFIEEGKRIAEWLVKNANGKSKIIELEGTTGSSP
ANDRKKGFDETIKAAGGFEIVASQSGDFARDKGRQVAEALLQAHPDADIVYAHNDEMAIG
AIAAIEAAGKVPGKDVLVLSIDGGKEAVQAVIDGKIAAVVECNPRFGPKAFETMLRYAKG
EKIDPMVINEDKFYDSSNAAAELANAY