Protein Info for SM_b21343 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 311 to 328 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 56 to 325 (270 residues), 150.3 bits, see alignment E=3.1e-48

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SM_b21343)

Predicted SEED Role

"Putative sugar ABC transport system, permease protein YtfT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V14 at UniProt or InterPro

Protein Sequence (334 amino acids)

>SM_b21343 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MTTIETQATAGTVPSGKRFFTLAGRYGTVAAFLALILFNVVFTPNFLSLQTLNVNLTQVA
TIVIVAIGMTLVIATGGIDLSVGSLMAIGGALAPMIFMGTLFPVSSMPVAVALAFVLPVV
ATGLLGLFNGLLVTRFAIQPIIATLVLFIAGRGIAQVMTNGNLQVFRNEGFQFIALGRVA
GIPAQVILMIAIAAIAWAAIRYTVFGRQVIAVGGNEKASRLTGIPVHRVKLLVYMISGAL
AGVAGLIVVARNSASDANLVGLGMELDAIAAVAVGGTLLTGGRANIVGTVIGALVIQLVR
YTLLANGVPDAAALIVKAALILLAVFIQQRAGKS