Protein Info for SM_b21342 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 53 to 84 (32 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 316 (271 residues), 132.3 bits, see alignment E=9.1e-43

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to sme:SM_b21342)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V15 at UniProt or InterPro

Protein Sequence (332 amino acids)

>SM_b21342 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MPMNSVLKALALKSPGDMARLGVILALFGLILFGALRYENFLSQYNILSFLRYNSMFALI
ALGMAFVIMTGGIDLSVGGTAAMASVVAALLSPYHWAAGLFGGIAAGFAVGALNGFTVTV
MRIQPFIATLATMLAAYGTGLLLAGNQSVSVSYDSGFTSIGQDDFLGFPIPAWIALLVYV
AGWLVLERLPVGRHVLAIGDGEATAALMGLKVRRTLAAVYVGSGALAGLAGVILASQFGA
GQPTEGVGWELFAIASVVVGGTLLTGGSGSVGATLAGALLLAMVFNILNFENGLGWISLS
AYWQSVIRGGFLLIVVVLQARLMSRRTGEEHV