Protein Info for SM_b21327 in Sinorhizobium meliloti 1021

Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF04321: RmlD_sub_bind" amino acids 1 to 291 (291 residues), 316.8 bits, see alignment E=2.3e-98 TIGR01214: dTDP-4-dehydrorhamnose reductase" amino acids 2 to 289 (288 residues), 303 bits, see alignment E=9.1e-95 PF01370: Epimerase" amino acids 3 to 178 (176 residues), 67 bits, see alignment E=3.4e-22 PF16363: GDP_Man_Dehyd" amino acids 35 to 138 (104 residues), 41.7 bits, see alignment E=2.1e-14 PF02719: Polysacc_synt_2" amino acids 37 to 144 (108 residues), 31.9 bits, see alignment E=1.7e-11

Best Hits

Swiss-Prot: 50% identical to RMLD_SINFN: dTDP-4-dehydrorhamnose reductase (NGR_a03570) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 100% identity to smk:Sinme_4804)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V29 at UniProt or InterPro

Protein Sequence (300 amino acids)

>SM_b21327 dTDP-4-dehydrorhamnose reductase (Sinorhizobium meliloti 1021)
MRIAVTGCEGQLALGLVERSHRRSGMEVVTIGRPHLDLTEPATILPAIERCRPDLVVSAA
AYTAVDQAESEPEAAFAVNAFGAGAVAEAAACLEVPIVHISTDYVFDGSKPRSYAEGDTP
APLSVYGASKLAGESAVAEATPRHLILRTGWVYSPFGKNFVKTILRLAEEREDIAVVADQ
RGNPSSAIDLADAILDISARLTKSRQDAAFGLYHLAGSGVVSRADFARHALAASRAAGGP
WAHVRDIATGGFPTPASRPANSSLSSAKFNATFGQAMPAWQGSVERTVRRLVESISSETS