Protein Info for SM_b21318 in Sinorhizobium meliloti 1021

Annotation: glycosyltransferase, forming alpha-glycosyl linkages protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF12000: Glyco_trans_4_3" amino acids 27 to 194 (168 residues), 189.8 bits, see alignment E=6.3e-60 PF00534: Glycos_transf_1" amino acids 212 to 379 (168 residues), 65.8 bits, see alignment E=7.6e-22 PF13692: Glyco_trans_1_4" amino acids 216 to 366 (151 residues), 54.9 bits, see alignment E=2.3e-18 PF13524: Glyco_trans_1_2" amino acids 319 to 395 (77 residues), 35.6 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4813)

Predicted SEED Role

"Probable glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ANQ1 at UniProt or InterPro

Protein Sequence (417 amino acids)

>SM_b21318 glycosyltransferase, forming alpha-glycosyl linkages protein (Sinorhizobium meliloti 1021)
MKMHVAFVHRRGFGQFAALARHLAEAGNEVTLVTETVDQRIPSVRVVRHRAEPGPQPNPH
IARHLGVPDHHVRIGHRVAETFDAMGRLGQSPDIVLGHIGWGSMMFVKDVLPRVPALGYC
EFFYRSEGADVGFAPDDRPDSETRKRLRLRNIAQLLSLEAMDGGISPTNWQKSLYPADAR
QRIAVCHEGVDTRRFRPDPAASLKLPDGRVLKAGDPVVTFVARDLEPYRGFPQALEAAAK
VVRRHPDALFVFVGGDGVSYGAPPPGGGSWKDHLLASLDVPRERLIFPGVVPHSVLRQLF
QISAAHLYLTYPFVLSWSVLEAMACGALVIGSDTAPVQEVIRSGRNGLLVPFFDTDALAE
TIVGALNRPDNFRELRGAARRTVEQRFRLDDCLARQLTLIGNLTGRNAAQAKETQFV