Protein Info for SM_b21317 in Sinorhizobium meliloti 1021

Annotation: transcriptional activator of exopolysaccharide II synthesis, MarR family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF12802: MarR_2" amino acids 78 to 135 (58 residues), 43 bits, see alignment E=4.3e-15 PF13463: HTH_27" amino acids 82 to 144 (63 residues), 27.1 bits, see alignment E=4.3e-10

Best Hits

Swiss-Prot: 100% identical to EXPG_RHIME: Exopolysaccharide II synthesis transcriptional activator ExpG (expG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21317)

Predicted SEED Role

"transcriptional activator of exopolysaccharide II synthesis, MarR family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P96440 at UniProt or InterPro

Protein Sequence (194 amino acids)

>SM_b21317 transcriptional activator of exopolysaccharide II synthesis, MarR family protein (Sinorhizobium meliloti 1021)
MERGMNHRILYPFADFGDTVAILPANETQRKGLDTPVDDRDGDDSLVTYFELARVMERAS
RRFSGLLRAELTKLGVEDIGPAQAMVLLAIGEAELSVGELLDRGHYVGSNISYYLKQLAD
GDYIDRIASQRDKRSARIRLSEKGRQLCAGLRQAAKGYERALSHGDQDRRNLETAFQTLH
RLELVWGNAARYGI