Protein Info for SM_b21315 in Sinorhizobium meliloti 1021

Annotation: HlyD family protein secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 55 to 75 (21 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 55 to 473 (419 residues), 342.2 bits, see alignment E=2.3e-106 PF25994: HH_AprE" amino acids 131 to 319 (189 residues), 130.8 bits, see alignment E=1.3e-41 PF26002: Beta-barrel_AprE" amino acids 361 to 448 (88 residues), 92.1 bits, see alignment E=3.8e-30

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to sme:SM_b21315)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ANQ2 at UniProt or InterPro

Protein Sequence (473 amino acids)

>SM_b21315 HlyD family protein secretion protein (Sinorhizobium meliloti 1021)
MNKEKILPVRLDLQPPVKTESPERRLPMAAPARLSAAMPEPDLSEDNTHSPIRRLVIAGL
TTILVAFGGFFGWAFSTELSSASVTSGTIVVDSKRKTVSHFEGGVLGRILVQEGDHVAPG
QPLMKLEDTRARSDLQALQSRRVGLIAKLARLRAERAGLHAVSFPADLVSEGEAAADAVT
AEKAFFEKRSEAKESRLAIQRKTIEEYSEKAKSLTAQLQATDRQIELMNEQRTAIATLVE
KAFAQRSKLIEIDARLSELAATRGELAGDKAQAEKAMAGAELALIGIESDFQSEIAGEIT
TARLELAEVEQRITAAEDVLRRLEIRAPQAGIVANIQLRTPGSAVTPGQPLLDIVPEDEP
LLVEMHVSTRDIDSITIGSSTQIRLTAYNQRSHLPLEGKVTYIAADQSVDEKSNVAYFVA
RAEVTPESLAANPDIRLYPGMPAEVLIVHKSRSAIDYLVAPVSDSFNRAFRED