Protein Info for SM_b21308 in Sinorhizobium meliloti 1021

Annotation: glycosyltransferase, forming alpha glycosyl linkages protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF13439: Glyco_transf_4" amino acids 81 to 221 (141 residues), 44 bits, see alignment E=6.2e-15 PF13579: Glyco_trans_4_4" amino acids 89 to 220 (132 residues), 30.9 bits, see alignment E=8.1e-11 PF20706: GT4-conflict" amino acids 213 to 431 (219 residues), 41.5 bits, see alignment E=2.2e-14 PF00534: Glycos_transf_1" amino acids 239 to 391 (153 residues), 77.8 bits, see alignment E=1.9e-25 PF13692: Glyco_trans_1_4" amino acids 240 to 386 (147 residues), 79.6 bits, see alignment E=7e-26

Best Hits

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_4823)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V35 at UniProt or InterPro

Protein Sequence (440 amino acids)

>SM_b21308 glycosyltransferase, forming alpha glycosyl linkages protein (Sinorhizobium meliloti 1021)
MSERLRVLVVSHGHPAMSLGGAEIASHSLHKGLNTLPGVESIYLARVGHPVPRHGASALM
SLRLAVDEVLFHADDYDHFFLSNGDTEAIRRDLLRFIGDLSPHVIHFHHLIGMGMEALYA
LREALPEAVIVVTFHEYLSLCHNHGQMVKRPSAQLCNSSSPISCHGCFPDIPVSRFLRRE
EFLRGMLGLADAFISPSMFLANRYVEWGIDAEKLSVIDNGIVMGEAAPVRDLPVPSARRN
RFAYFGQMTPFKGIDVLVDAVSRVPEEIWGEDSCLMIFGGNLERQPAEFQERLKKLIDDA
GRRVRFYGAYQNADMPRLMRSVDWVVLPSIWWENSPVVIQEALHHRRPIICSDIGGMAEK
VQDGRDGLHFRAGSAQDLADRLSDVLVKPEAWDRLHATLRPPTGHAESARAHADLYRRLL
KDRRSPLGAAQYEAAAQAVV