Protein Info for SM_b21304 in Sinorhizobium meliloti 1021

Annotation: NG,NG-dimethylarginine dimethylaminohydrolase (dimethylargininase) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF19420: DDAH_eukar" amino acids 37 to 172 (136 residues), 30.2 bits, see alignment E=2.8e-11 PF02274: ADI" amino acids 64 to 187 (124 residues), 24.4 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: K01482, dimethylargininase [EC: 3.5.3.18] (inferred from 100% identity to sme:SM_b21304)

Predicted SEED Role

"NG,NG-dimethylarginine dimethylaminohydrolase 1 (EC 3.5.3.18)" in subsystem Dimethylarginine metabolism (EC 3.5.3.18)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VA0 at UniProt or InterPro

Protein Sequence (264 amino acids)

>SM_b21304 NG,NG-dimethylarginine dimethylaminohydrolase (dimethylargininase) protein (Sinorhizobium meliloti 1021)
MTRPAYQFNSIIVRSPSRSVVNGLRAEDRGSPTYEGVKAEHDAYVEAMRDAGVKVTVLPA
LEAFPDSIFVEDPALVFTEGAVLLRPGAATRVKEVEEIAPTLRDMFETVLDLPQGYADGG
DVLTTRESVMIGLSARTDTAGAAALQACLEKLGRKSEVVATPEGVLHFKTDCSLLDDETI
LSTDRLARSGVFGEFRQMIIPEGEEPAANALRVNDVVLVGSDFPRTIEMLDKAGYRVVPL
KTTEIGKIDAGLSCMSLRWFSEKV