Protein Info for SM_b21300 in Sinorhizobium meliloti 1021

Annotation: deoxyribose-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR00126: deoxyribose-phosphate aldolase" amino acids 69 to 292 (224 residues), 141.5 bits, see alignment E=1.3e-45 PF01791: DeoC" amino acids 70 to 282 (213 residues), 67.3 bits, see alignment E=8.1e-23

Best Hits

Swiss-Prot: 60% identical to DEOC_HUMAN: Deoxyribose-phosphate aldolase (DERA) from Homo sapiens

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 100% identity to sme:SM_b21300)

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.4

Use Curated BLAST to search for 4.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VA4 at UniProt or InterPro

Protein Sequence (334 amino acids)

>SM_b21300 deoxyribose-phosphate aldolase (Sinorhizobium meliloti 1021)
MEDLALKSAAVHPAGAGHNWPRNDGVELDLSWVLDQRVNLSAAERRVQTLPGRRTVKKDA
QAAWLLKAVTCIDLTTLNGDDTAERVKRLCAKARQPVRQDILDALGMGDRGITTGAICVY
HRFVSTAVEALEGSGIPVAAVSTGFPAGLVPHDVKLREIKASVADGAREIDIVITREHVL
TGNWQALYDEMRDFRAACGDAHVKAILATGDLKTLRNVARASLVCMMAGADFIKTSTGKE
GVNATLLVTLAMLRMIRAYEERTGIKVGYKPAGGISVAKDVLNYQFLMKEELGREWLEPD
LFRVGASSLLADIERQLEHHVSGAYSALNRHPIG