Protein Info for SM_b21286 in Sinorhizobium meliloti 1021

Annotation: xanthine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02963: xanthine dehydrogenase, small subunit
  • amino acids 9 to 477 (469 residues), 700.9 bits, E=3.6e-215
• PF00111: Fer2
  • amino acids 14 to 74 (61 residues), 24.1 bits, E=5.7e-09
• PF01799: Fer2_2
  • amino acids 88 to 161 (74 residues), 106.3 bits, E=1.4e-34
• PF00941: FAD_binding_5
  • amino acids 204 to 367 (164 residues), 181 bits, E=3.4e-57
• PF03450: CO_deh_flav_C
  • amino acids 376 to 476 (101 residues), 119.5 bits, E=1.3e-38

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 100% identity to smk:Sinme_4915)

Predicted SEED Role

"Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4) / Xanthine dehydrogenase, FAD binding subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• ureide biosynthesis (6/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• caffeine degradation III (bacteria, via demethylation) (2/7 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (2/10 steps found)
• theophylline degradation (1/9 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

See Q92VB8 at UniProt or InterPro

Protein Sequence (493 amino acids)

>SM_b21286 xanthine dehydrogenase (Sinorhizobium meliloti 1021)
MTTEIRNTIRFLLNDRPVELADVSPVQTLLDFLRIDRSLRGTKEGCAEGDCGACTVLVGR
LLDGKLKYESVNACIRFVASLDGCHVVTVEALAQPNGPLHPVQQAMVDTHASQCGFCTPG
FVMSLYGLWMTNAKPSVQEIEKALQGNLCRCTGYAAIIRAAEAIASVGELGKDPLIVERE
EITRQLEALRDGCRVEIGGEDERVVLPASLDDFAAVLEANPKATIVAGSTDVGLWVTKFM
RDIAPVVHLSHLEELRRISIAPDGITLAAGVSYTEAYPVIVRNFPQLRELWDRIGGEQVR
NMGTVGGNIANGSPIGDTPPALIALGASVTLRKGTSRRTLPLEAFFIEYGKQDREPGEFV
ETVRIPFLDETERFAVYKITKRFDEDISAVCGAFRVKLDGDGKVADVAIAFGGMAGTPKR
ASNVEAALKGAQWNDAAIEAGVAALERDFTPLTDWRASSEYRMLVARNLLRRFHLETQET
RNIRIDRTVAVAM