Protein Info for SM_b21279 in Sinorhizobium meliloti 1021

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR01891: amidohydrolase" amino acids 14 to 372 (359 residues), 330.5 bits, see alignment E=7.1e-103 PF01546: Peptidase_M20" amino acids 73 to 385 (313 residues), 156.3 bits, see alignment E=1e-49 PF07687: M20_dimer" amino acids 184 to 274 (91 residues), 33.9 bits, see alignment E=2.7e-12

Best Hits

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 100% identity to sme:SM_b21279)

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VC5 at UniProt or InterPro

Protein Sequence (389 amino acids)

>SM_b21279 amidohydrolase (Sinorhizobium meliloti 1021)
MRVPPGIADDLTFLTAFRRDLHAHPELGFEEERTSDLVARILEEAGLRVHRGLGKTGVVG
TLQVGNGTRAIGLRADMDALAMPELADRPYKSTVAGKMHACGHDGHTTMLLGAARHLAAT
RNFSGMVHFIFQPAEEGRGGARRMVEDGLFDLFPCDAVYGLHNMPGLAVDEMAVVAGPQL
ASSDSWRLTFRGVGTHGAKPHLGRDPITAAGTFLASLQTVVGRVVDPLQPAVVSACALQA
GDPKALNVIPDTVEIGGTARAYTPHVRDQLEEEIGRLALGTAAMYGIEADYRFERRIPPV
VNDPDATARALSAARSVFGEKALTSFPPSTAGDDFAFFALEAPGCYVWLGNGPAVDGALH
HNSAYDFNDAAIGPGAAFWTALVEQELKA