Protein Info for SM_b21263 in Sinorhizobium meliloti 1021

Annotation: mureinpeptideoligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 157 to 183 (27 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 278 to 306 (29 residues), see Phobius details amino acids 328 to 351 (24 residues), see Phobius details PF12911: OppC_N" amino acids 12 to 64 (53 residues), 52.3 bits, see alignment 4.3e-18 PF00528: BPD_transp_1" amino acids 174 to 361 (188 residues), 94.1 bits, see alignment E=9.2e-31

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to sme:SM_b21263)

Predicted SEED Role

"Oligopeptide ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VE0 at UniProt or InterPro

Protein Sequence (363 amino acids)

>SM_b21263 mureinpeptideoligopeptide ABC transporter permease (Sinorhizobium meliloti 1021)
MTEEQVRVNQASQLRLMWWKFKRHKVALASGIFLAVLYGMILICEFLAPYDLHTRNVDFI
YAPPQRIHFFHEGEFVGPFVYGRTMTLDMDTLKRNYADDTSKVEPIRFFCRGDDYRFWGL
FESNLHLVCPAEGGQLFLLGTDRLGRDVLSRIIYGARISLTIGLLGITVSFVLGIVIGGL
AGYHGGIFDLVVQRLIEVLQSIPSIPLWLSLAAIMPATWSPLLIYLGITVILGLLDWTGL
ARAVRSKLLALREEDYVLAAQLMGARSGRIIGRHLVPGFMSHLIATATISIPGMILGETA
LSFLGLGLRPPITSWGILLTEAKSVSVIAFYPWLLFPTIPVILVILAFNFLGDGLRDAAD
PYK