Protein Info for SM_b21262 in Sinorhizobium meliloti 1021

Annotation: mureinpeptideoligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 138 to 164 (27 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 248 to 274 (27 residues), see Phobius details amino acids 294 to 320 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 104 (104 residues), 31.5 bits, see alignment E=1.7e-11 PF00528: BPD_transp_1" amino acids 120 to 325 (206 residues), 94.4 bits, see alignment E=7.6e-31

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to smk:Sinme_4938)

Predicted SEED Role

"FIG01075993: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VE1 at UniProt or InterPro

Protein Sequence (332 amino acids)

>SM_b21262 mureinpeptideoligopeptide ABC transporter permease (Sinorhizobium meliloti 1021)
MLRYILWRIAVMVPTLLIISALVFAIIELPPGDYFESYIAEIRAQGEGVNMEQIEALRKQ
YGFDQPPILRYVHWVAGMLQGDFGYSFEYELPVSEVVGERLWLTVLVSFVTIIFTWVIAF
PIGLYAATHQYSWGDYGLSLIGLIGIAIPNFMLALVLMYFANIWFGTSIGHLMDQKYLSE
PMSWEKAKSILEHIWIPVIIVGAAGTAGMIRRLRANLLDELQKQYVVTARAKGLSPTRTL
LKYPLRMALNFFISDIGSILPAIISGAEITAIVLSLETTGPMLIKALQSQDMYLAGSFLM
FLAFLTVIGVLVSDLALAVLDPRIRLQGRSTK