Protein Info for SM_b21260 in Sinorhizobium meliloti 1021

Annotation: mureinpeptideoligopeptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 PF00005: ABC_tran" amino acids 28 to 194 (167 residues), 83.4 bits, see alignment E=8.1e-27 amino acids 338 to 492 (155 residues), 115.5 bits, see alignment E=1e-36 PF13304: AAA_21" amino acids 117 to 229 (113 residues), 31.5 bits, see alignment E=6.5e-11 PF08352: oligo_HPY" amino acids 245 to 281 (37 residues), 29.2 bits, see alignment 3.4e-10 amino acids 544 to 576 (33 residues), 27.1 bits, see alignment (E = 1.5e-09)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to sme:SM_b21260)

Predicted SEED Role

"ATP-binding component of a ABC transport system (oligopeptide)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VE2 at UniProt or InterPro

Protein Sequence (630 amino acids)

>SM_b21260 mureinpeptideoligopeptide ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MTSGADLLRVEGLRITFSVLGGEVEAVRGANFRILPGRVTALVGESGSGKSAISQAIMGI
LPSVASVGGRVLFNDPEAEANPVDLLSLDRDGRDIQEIRGARISKIFQEPMTSLSPLHTI
GNQISEVLKIHTDADKAGRRERTEELLGYVGFSDPKRAYDMYPFELSGGMRQRAMIAMAL
ICRPALLIADEPTTALDVTVQAQILQLLRELQSKLNMAMLLITHDLGVVANMADEVVVIY
HGEIVEAGPVDAIFRNPRHPYLKGLMAAVPHFDMKPGERLKALREVPVKAGAIVGDREVK
KAAGPNVLVSVRNLSKTFSTRSSGWFGSGTAYRHRAVDNVSFDIRRGECLGLVGESGCGK
TTVSKILMRAVTPDKGTITFDDGEGALDVLKLDGGELKALRAKIQMVFQDPVSSLSPRMT
VKNILSEPLEIHGRGTPKSREEHVRSLLQAVGLDQRFINRYPHSFSGGQRQRIGIARALA
LVPQLLICDEPVSALDVSVQAQILNLLKDLQKELGLTMLFISHNLAVVDYMADRIAVMCA
GRIVELAPREVLMRNPVHPYTRSLLAAVPYPDLDRKLDFDSLQASGGSDQQRWGAQFSDG
GENGALIPADLGGGHYVLARRSVDARELRR