Protein Info for SM_b21256 in Sinorhizobium meliloti 1021

Annotation: nucleotide sugar oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF03721: UDPG_MGDP_dh_N" amino acids 51 to 226 (176 residues), 151.6 bits, see alignment E=4.7e-48 TIGR03026: nucleotide sugar dehydrogenase" amino acids 51 to 462 (412 residues), 421.4 bits, see alignment E=1.7e-130 PF03446: NAD_binding_2" amino acids 51 to 180 (130 residues), 29.5 bits, see alignment E=1.9e-10 PF00984: UDPG_MGDP_dh" amino acids 248 to 338 (91 residues), 109.7 bits, see alignment E=1.6e-35 PF03720: UDPG_MGDP_dh_C" amino acids 366 to 465 (100 residues), 77.4 bits, see alignment E=2.5e-25

Best Hits

KEGG orthology group: K13015, UDP-N-acetyl-D-glucosamine dehydrogenase [EC: 1.1.1.-] (inferred from 100% identity to sme:SM_b21256)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.22

Use Curated BLAST to search for 1.1.1.- or 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VE6 at UniProt or InterPro

Protein Sequence (477 amino acids)

>SM_b21256 nucleotide sugar oxidase (Sinorhizobium meliloti 1021)
MTCGGFPANKTTPGSAAGSLKRPSRQQNWTPILTSPHHDRLLESISGRTARVGVIGLGYV
GLPLAVAVARSGFHVTGFDIDPGKIVALDAGSSYIEAVSDEALAREAGAGRFRSTTDFSD
LGFCDVIIICVPTPLTRHRDPDLSFVENTSRAIADCLRPGQLVVLESTTYPGTTDGIVRS
ILEETGLKSGTDFFIGFSPEREDPGNRAYETTSIPKVVAGDGPMAAGLMERFYAAVVTTV
VPVSSNATAEAVKLTENIFRAVNIALVNELKVVYEAMGIDVWEVIDAAKTKPFGYMPFYP
GPGLGGHCIPIDPFYLTWKSREYELPTRFIELAGEINSAMPRHVMARLAEALDRREGKAL
SRSAVLVIGLAYKKNVPDIRESPSLKLIELIEERGGKAAFYDPHVEEIPSTREHMALKGR
RSVVFDEATVRGFDAVLIATDHDAVDYAALADWSPLIVDTRNVFARLGLAAEHIVKA