Protein Info for SM_b21244 in Sinorhizobium meliloti 1021

Annotation: membrane protein, polysaccharide transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 8 to 30 (23 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details amino acids 342 to 366 (25 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 403 to 421 (19 residues), see Phobius details PF01943: Polysacc_synt" amino acids 5 to 292 (288 residues), 55.1 bits, see alignment E=7.9e-19 PF13440: Polysacc_synt_3" amino acids 30 to 293 (264 residues), 32.3 bits, see alignment E=6.4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21244)

Predicted SEED Role

"FIG01075922: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VF7 at UniProt or InterPro

Protein Sequence (429 amino acids)

>SM_b21244 membrane protein, polysaccharide transporter (Sinorhizobium meliloti 1021)
MLERLQSIAHLLTGNILSSVIGLIGFALTARALGPAGYGILALCFSYTRAVERIVSFQSW
QPLIKYGAHSLAENADDATELRALLKFGLLLDISAALVGWLVAVLLILVVAPWLGISGDG
ADLAILYCTVLPFQVSGMPTAVLRLYGRFMAIAYGQVATSVLRVVLCAIGVATGAGLFEF
TLIWMSAQIIGTLILVLFALAELRRQGVLSGLMSVPLRGITKRFPGLWKFAISANLSLTI
RSSANELDTLLVGYLADPTSAGLYHIAKRIGRIAQQAGVQVQAVLYPELARAWATKALSA
FHRAVAQMQGLLLGCGLLLIGGLYLLIGPLLTWAAGPDFAAAGPLVIVQSVAVTMTLCGA
VIRSALLAMGRENEILRSVTIAAIGFHATAFALIPVIGAMGANVAHIVMASIWLSTMMLS
YRRTPAPET