Protein Info for SM_b21228 in Sinorhizobium meliloti 1021

Annotation: nucleotide sugar epimerase dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 293 (293 residues), 65.6 bits, see alignment E=1.4e-21 PF01073: 3Beta_HSD" amino acids 4 to 219 (216 residues), 52.3 bits, see alignment E=1.6e-17 PF01370: Epimerase" amino acids 4 to 230 (227 residues), 159.8 bits, see alignment E=2.8e-50 PF13460: NAD_binding_10" amino acids 7 to 167 (161 residues), 48.9 bits, see alignment E=2.7e-16 PF07993: NAD_binding_4" amino acids 61 to 212 (152 residues), 28.9 bits, see alignment E=2.3e-10 PF16363: GDP_Man_Dehyd" amino acids 61 to 251 (191 residues), 49.8 bits, see alignment E=1.3e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4968)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VH2 at UniProt or InterPro

Protein Sequence (311 amino acids)

>SM_b21228 nucleotide sugar epimerase dehydratase (Sinorhizobium meliloti 1021)
MRLVVTGATGFIGARLIDRALSRGYEVTALARDPERAAARIGARLGVEKWSIGDPLPPLA
QSDAVLHLAAYIPADLSDARQAARCFEINTNGAIQIAMEAASQGVKRFVLFGSAQVYAPG
TEPASEASPAYPVHRASYYLASKLAAEICVLAFGKSSAMPVTVLRLASVYGPGMHDTGMV
PTFVRTLGSGRSLVIQDGGRYSVDLVYVDDVVTLALQAVETAEGGVFNAGSGRACTSLEA
AQIVADAVGAERHLIAVEGDSTDAAPRGFRVLNVSKAANELSYAPLSFREGIEAWKSMTG
LTDFQDGSVNA