Protein Info for SM_b21219 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for D-Glucosamine, permease component 1
Rationale: Specific phenotypes on D-Glucosamine Hydrochloride.
Original annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 77 to 77 (1 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 137 to 137 (1 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 272 (180 residues), 53.9 bits, see alignment E=9.6e-19

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to sme:SM_b21219)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VI0 at UniProt or InterPro

Protein Sequence (281 amino acids)

>SM_b21219 ABC transporter for D-Glucosamine, permease component 1 (Sinorhizobium meliloti 1021)
MERQSPLFSVFIHASALLLAVVILAPVAWLLIMSISPAADLSAKPLAWWPSDIDLSRYRT
LLSAVENSAGAAFIASLLNSIKVAGMATLAAVVVAVPAAWAVSRTPAVAWSLYAVIATYM
LPPVALAVPLYMGLAYFGLLNSVFGLALVYLTILAPFTTWLLKSGFDSIPREIESAAMID
GARLDQILRILTLPLAAPVMATSALFAFLLAWDEFFYALLFTSDQRAKTLTVAIADLAGG
RVSDYGLIATAGVLAALPPVLIGLIMQRALISGLTSGGVKG