Protein Info for SM_b21218 in Sinorhizobium meliloti 1021

Updated annotation (from data): glucosamine-6-phosphate deaminase, isomerizing (EC 3.5.99.6)
Rationale: Specifically important for utilizing D-glucosamine
Original annotation: sugar-processing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_4978)

Predicted SEED Role

"Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

N-acetylglucosamine degradation II (3/3 steps found)
N-acetylglucosamine degradation I (2/2 steps found)
superpathway of N-acetylneuraminate degradation (16/22 steps found)
UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (4/6 steps found)
chitin derivatives degradation (4/8 steps found)
chitin degradation I (archaea) (1/7 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.99.6

Use Curated BLAST to search for 3.5.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VI1 at UniProt or InterPro

Protein Sequence (339 amino acids)

>SM_b21218 glucosamine-6-phosphate deaminase, isomerizing (EC 3.5.99.6) (Sinorhizobium meliloti 1021)
MSISKDRPAGLIAIDREMARQHADAIASYEGATATAQRIAASLKSTGRLLLLGMGGSHAV
GRAVEPLYRALGIEAVAVPLSEQLGEPLSIEGKTILVTSQSGESAEVLRWFRETDGGTSE
TFGLTLEEDAFLAKAVPSLVGSGGTERAFAATRSLTVTFALHLAVLAALGADPADALRAL
RDPEAPVIDGALAALADVGAIVTSGRKLQGLAEAIALGLTELSRLPCFSLEGGQLRHGPM
EMLGASVGVVLFRAADPTAKLVGAMATSAAEAGSPVIVFDASDESPAAGATTIRFKPAAG
LAAILAMLPVAQSLMIAFADARVENAGTPVRSTKVTRSE